Tripartite Motif Containing 33 (TRIM33) antibody

Antigen: Tripartite Motif Containing 33 (TRIM33)

Synonyms: PTC7, RFG7, TF1G, TIF1G, FLJ32925, TIFGAMMA, TIF1GAMMA, Tif1g, AI413936, mKIAA1113, 8030451N04Rik, DKFZp586K1123, tif1g, cb1085, MGC136680, id:ibd2175, wu:fc17f10, zgc:136680, TRIM33, ptc7, rfg7, tf1g, tifgamma, MGC146665, tif1gamma

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405205

Additional Information

Alternative name: TIF1-gamma / TRIM33

Gene ID: TRIM33

UniProt: Q9UPN9

Immunogen: The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33

Sequence: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLK SDERPVHIK

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRIM33 antibody concentration is 1 mg/ml.

Description: TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Characteristics: Antigen Size: 1127 amino acids

Molecular Weight: 122kDa

Synonyms: PTC7, RFG7, TF1G, TIF1G, FLJ32925, TIFGAMMA, TIF1GAMMA, Tif1g, AI413936, mKIAA1113, 8030451N04Rik, DKFZp586K1123, tif1g, cb1085, MGC136680, id:ibd2175, wu:fc17f10, zgc:136680, TRIM33, ptc7, rfg7, tf1g, tifgamma, MGC146665, tif1gamma

Application Details

Application Notes: WB Suggested Anti-TRIM33 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRIM33 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate

Publications

Product: He, Dorn, Erdjument-Bromage et al.: "Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway." in: Cell, Vol. 125, Issue 5, pp. 929-41, 2006 (PubMed).