Lysine (K)-Specific Demethylase 6A (KDM6A) antibody

Antigen: Lysine (K)-Specific Demethylase 6A (KDM6A)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN405243

Additional Information

Alternative name: UTX / KDM6A

Gene ID: UTX

UniProt: O15550

Immunogen: The immunogen for anti-UTX antibody: synthetic peptide directed towards the middle region of human UTX

Sequence: KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFT LAPPLPSASS

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-UTX antibody concentration is 1 mg/ml.

Description: UTX is a histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. It demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. UTX plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitent with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.

Characteristics: Antigen Size: 1401 amino acids

Molecular Weight: 154kDa

Application Details

Application Notes: WB Suggested Anti-UTX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-UTX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Publications

Product: Hong, Cho, Yu et al.: "Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 47, pp. 18439-44, 2007 (PubMed).