SRY (Sex Determining Region Y)-Box 17 (SOX17) antibody
| Antigen | SRY (Sex Determining Region Y)-Box 17 (SOX17) |
| Synonyms |
MGC91776, FLJ22252, sox17, Xsox17, sox17beta, sox17-beta, tSox17beta, Xsox17-beta, SOX17, xsox17a, Sox17alpha, sox17-alpha, tSox17alpha, Xsox17-alpha, xSox17alpha1, xSox17alpha2, sox17a, xsox17, sox17 ...
show more
|
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Dog (Canine), Human, Mouse (Murine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
 |
1 reference available |
| Catalog no. | ABIN405250 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | SOX17 |
| Gene ID | SOX17 |
| UniProt | Q9H6I2 |
| Immunogen | The immunogen for anti-SOX17 antibody: synthetic peptide directed towards the middle region of human SOX17 |
| Sequence | RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVV SDASSAVYYC |
| Cross-Reactivity | Dog (Canine), Human, Mouse (Murine) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-SOX17 antibody concentration is 1 mg/ml. |
| Description | The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
| Characteristics | Antigen Size: 414 amino acids |
| Molecular Weight | 44kDa |
| Synonyms | MGC91776, FLJ22252, sox17, Xsox17, sox17beta, sox17-beta, tSox17beta, Xsox17-beta, SOX17, xsox17a, Sox17alpha, sox17-alpha, tSox17alpha, Xsox17-alpha, xSox17alpha1, xSox17alpha2, sox17a, xsox17, sox17a1, MGC131036, xsox17-alpha, sox17b, sox17b.1, Sox17beta, XSox17beta, xsox17-beta, sox17a2, MGC68799, Xsox17alpha, sox17b.3, sox7/17 |
Application Details
| Application Notes |
WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Embryogenesis, Embryonic stem cells, Transcription Factors |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate anti-SRY (Sex Determining Region Y)-Box 17 (SOX17) antibody (Image 2) |
Publications
| Product |
Zhang, Glöckner, Guo et al.: "Epigenetic inactivation of the canonical Wnt antagonist SRY-box containing gene 17 in colorectal cancer." in: Cancer research, Vol. 68, Issue 8, pp. 2764-72, 2008 (PubMed).
|
Alternatives
Alternatives for antigen "SRY (Sex Determining Region Y)-Box 17 (SOX17)", type "Antibodies"
| Hosts | Rabbit (27), Mouse (17), Goat (6) |
| Reactivities | Human (48), Mouse (Murine) (21), Rat (Rattus) (20), Chicken (2), Dog (Canine) (2), Monkey (2), Opossum (Didelphimorphia) (2), Cow (Bovine) (1), Pig (Porcine) (1), Zebrafish (1), Zebrafish (Danio rerio) (1) |
| Applications | Immunofluorescence (IF) (25), Western Blotting (WB) (24), ELISA (12), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Flow Cytometry (FACS) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1) |
| Conjugates | APC (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1) |
| Epitopes | AA 177-414 (13), AA 120-170 (2), AA 70-120 (2), Internal Region (2), C-Term (1) |
