SnRNP-D2 / Sm-D2 antibody

Antigen: SnRNP-D2 / Sm-D2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN405338

Additional Information

Gene ID: SNRPD2

Immunogen: The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the middle region of human SNRPD2

Sequence: ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVI VVLRNPLIAG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SNRPD2 antibody concentration is 1 mg/ml.

Description: SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis.The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Characteristics: Antigen Size: 118 amino acids

Molecular Weight: 13kDa

Application Details

Application Notes: WB Suggested Anti-SNRPD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SNRPD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).