Nucleolar Protein 6 (NOL6) antibody

Antigen: Nucleolar Protein 6 (NOL6)

Synonyms: NRAP, UTP22, FLJ21959, MGC14896, MGC14921, MGC20838, bA311H10.1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN405371

Additional Information

Alternative name: NOL6

Gene ID: NOL6

UniProt: Q9H6R4

Immunogen: The immunogen for anti-NOL6 antibody: synthetic peptide directed towards the N terminal of human NOL6

Sequence: SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRET EILFHSSLLR

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NOL6 antibody concentration is 1 mg/ml.

Description: NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.

Characteristics: Antigen Size: 1146 amino acids

Molecular Weight: 127kDa

Application Details

Application Notes: WB Suggested Anti-NOL6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-NOL6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate

Publications

Product: Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).