Fibulin 3 (FBLN3) antibody

Antigen: Fibulin 3 (FBLN3)

Synonyms: DHRD, DRAD, FBNL, MLVT, MTLV, S1-5, FBLN3, FLJ35535, MGC111353, MGC37612, T16

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405398

Additional Information

Alternative name: Fibulin-3

Gene ID: EFEMP1

UniProt: Q12805

Immunogen: The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1

Sequence: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENG EFYLRQTSPV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-EFEMP1 antibody concentration is 1 mg/ml.

Description: EFEMP1 gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.This gene spans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

Characteristics: Antigen Size: 493 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-EFEMP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Weedon, Lango, Lindgren et al.: "Genome-wide association analysis identifies 20 loci that influence adult height." in: Nature genetics, Vol. 40, Issue 5, pp. 575-83, 2008 (PubMed).