Tripartite Motif Containing 72 (TRIM72) antibody

Antigen: Tripartite Motif Containing 72 (TRIM72)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN405512

Additional Information

Alternative name: TRIM72 / MG53

Gene ID: TRIM72

UniProt: Q6ZMU5

Immunogen: The immunogen for anti-TRIM72 antibody: synthetic peptide directed towards the middle region of human TRIM72

Sequence: LEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQ FDKAVAVVAH

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRIM72 antibody concentration is 1 mg/ml.

Description: TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.

Characteristics: Antigen Size: 477 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-TRIM72 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRIM72 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Publications

Product: Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).