Did you know that you can buy products from over 140 different suppliers from us?

Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3) (N-Term) antibody

Details for Product No. ABIN405515
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms eff, fb36f02, wu:fb36f02, zgc:56340, E2(17)KB3, UBC4/5, UBCH5C, AA414951, 1100001F19Rik, 9430029A22Rik, UBE2D3P, Ube2d2, zgc:55886, Xubc4, e2(17)kb3, ubc4/5, ubch5c, ube2d3.1
Epitope
N-Term
(9), (8), (6), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(38), (15), (15), (12), (12), (12)
Host
Rabbit
(28), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (22), (10), (4), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405515
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UBE2D3
Sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGP NDSPYQGGVF
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against UBE2D3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UBE2D3
Background The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.
Molecular Weight 17 kDa
Gene ID 7323
NCBI Accession NM_003340, NP_003331
UniProt P61077
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 147 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3) (N-Term) antibody WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Background publications Hattori, Zhang, Jia et al.: "RNAi screen identifies UBE2D3 as a mediator of all-trans retinoic acid-induced cell growth arrest in human acute promyelocytic NB4 cells." in: Blood, Vol. 110, Issue 2, pp. 640-50, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405515
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top