Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3) antibody

Antigen: Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3)

Synonyms: UBC4/5, UBCH5C, MGC5416, MGC43926, E2(17)KB3, AA414951, 1100001F19Rik, 9430029A22Rik, UBE2D3P, UBE2D3, Ube2d2, MGC55886, zgc:77149, Xubc4, ubc4/5, ubch5c, e2(17)kb3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Pig (Porcine), Xenopus laevis, Dog (Canine), Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405515

Additional Information

Alternative name: UBE2D3

Gene ID: UBE2D3

UniProt: P61077

Immunogen: The immunogen for anti-UBE2D3 antibody: synthetic peptide directed towards the N terminal of human UBE2D3

Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGP NDSPYQGGVF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-UBE2D3 antibody concentration is 1 mg/ml.

Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.

Characteristics: Antigen Size: 147 amino acids

Molecular Weight: 17kDa

Application Details

Application Notes: WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-UBE2D3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Publications

Product: Hattori, Zhang, Jia et al.: "RNAi screen identifies UBE2D3 as a mediator of all-trans retinoic acid-induced cell growth arrest in human acute promyelocytic NB4 cells." in: Blood, Vol. 110, Issue 2, pp. 640-50, 2007 (PubMed).