Tripartite Motif Containing 60 (TRIM60) antibody

Antigen: Tripartite Motif Containing 60 (TRIM60)

Synonyms: RNF33, RNF129, FLJ35882, MGC119325

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405563

Additional Information

Alternative name: TRIM60 / RNF129 / RNF33

Gene ID: TRIM60

UniProt: Q495X7

Immunogen: The immunogen for anti-TRIM60 antibody: synthetic peptide directed towards the N terminal of human TRIM60

Sequence: LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEI NSEFEQIRLF

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRIM60 antibody concentration is 1 mg/ml.

Description: TRIM60 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1842 AK093201.1 2-1843

Characteristics: Antigen Size: 471 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-TRIM60 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRIM60 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Saurin, Borden, Boddy et al.: "Does this have a familiar RING?" in: Trends in biochemical sciences, Vol. 21, Issue 6, pp. 208-14, 1996 (PubMed).