Ectodysplasin A (EDA) antibody

Antigen: Ectodysplasin A (EDA)

Synonyms: ED1, HED, EDA1, EDA2, XHED, XLHED, ED1-A1, ED1-A2, EDA, si:ch73-223d24.5

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405665

Additional Information

Alternative name: Ectodysplasin-A

Gene ID: EDA

UniProt: B7ZLU4

Immunogen: The immunogen for anti-EDA antibody: synthetic peptide directed towards the middle region of human EDA

Sequence: HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSG ELEVLVDGTY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-EDA antibody concentration is 1 mg/ml.

Description: EDA is a type II membrane protein that can be cleaved by furin to produce a secreted form. It belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene.

Characteristics: Antigen Size: 389 amino acids

Molecular Weight: 41kDa

Application Details

Application Notes: WB Suggested Anti-EDA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-EDA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Zhao, Hua, Zhao et al.: "Three novel mutations of the EDA gene in Chinese patients with X-linked hypohidrotic ectodermal dysplasia." in: The British journal of dermatology, Vol. 158, Issue 3, pp. 614-7, 2008 (PubMed).

Zhao, Watt, Battle et al.: "Loss of both GATA4 and GATA6 blocks cardiac myocyte differentiation and results in acardia in mice." in: Developmental biology, Vol. 317, Issue 2, pp. 614-9, 2008 (PubMed).