Tectonic Family Member 3 (TCTN3) antibody

Antigen: Tectonic Family Member 3 (TCTN3)

Synonyms: RGD1305166, TECT3, C10orf61, DKFZp564D116, Tect3, AI197391, 4930521E07Rik, CVAL, VALOP

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN405686

Additional Information

Alternative name: Tectonic-3

Gene ID: TCTN3

UniProt: Q6NUS6

Immunogen: The immunogen for anti-TCTN3 antibody: synthetic peptide directed towards the middle region of human TCTN3

Sequence: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTT CTRFFKNLAS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCTN3 antibody concentration is 1 mg/ml.

Description: TCTN3 may be involved in apoptosis regulation.

Characteristics: Antigen Size: 607 amino acids

Molecular Weight: 64kDa

Application Details

Application Notes: WB Suggested Anti-TCTN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TCTN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Reiter, Skarnes: "Tectonic, a novel regulator of the Hedgehog pathway required for both activation and inhibition." in: Genes & development, Vol. 20, Issue 1, pp. 22-7, 2006 (PubMed).