Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 3 Open Reading Frame 17 (C3orf17) antibody

Antigen

Chromosome 3 Open Reading Frame 17 (C3orf17)

Synonyms NET17, DKFZp434F2021, MGC82019
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN405698
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C3orf17
Gene ID C3orf17
UniProt Q6NW34
Immunogen The immunogen for anti-C3orf17 antibody: synthetic peptide directed towards the middle region of human C3orf17
Sequence KQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSWTVMQI NKNSTSGTIK
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C3orf17 antibody concentration is 1 mg/ml.
Description The function of the C3orf17 protein remains unknown.
Characteristics Antigen Size: 567 amino acids
Molecular Weight 64kDa

Application Details

Application Notes WB Suggested Anti-C3orf17 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 3 Open Reading Frame 17 (C3orf17)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2)