Ras Homolog Gene Family, Member T1 (RHOT1) antibody

Antigen: Ras Homolog Gene Family, Member T1 (RHOT1)

Synonyms: ARHT1, MIRO-1, FLJ11040, FLJ12633, Arht1, Miro1, AA415293, AF244542, AI834919, 2210403N23Rik, C430039G08Rik, MGC156790, rhot1, zgc:55581, zgc:77063, wu:fd14e11, wu:fi14a05, RHOT1, rasl, arht2, miro-2, MGC89266, MGC128572, miro1, si:dkeyp-97g3.6

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN405704

Additional Information

Alternative name: RHOT1

Gene ID: RHOT1

Immunogen: The immunogen for anti-RHOT1 antibody: synthetic peptide directed towards the N terminal of human RHOT1

Sequence: EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNT PLAPQALEDV

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RHOT1 antibody concentration is 1 mg/ml.

Description: RHOT1 is mitochondrial GTPase involved in mitochondrial trafficking. It is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Characteristics: Antigen Size: 659 amino acids

Molecular Weight: 75kDa

Synonyms: ARHT1, MIRO-1, FLJ11040, FLJ12633, Arht1, Miro1, AA415293, AF244542, AI834919, 2210403N23Rik, C430039G08Rik, MGC156790, rhot1, zgc:55581, zgc:77063, wu:fd14e11, wu:fi14a05, RHOT1, rasl, arht2, miro-2, MGC89266, MGC128572, miro1, si:dkeyp-97g3.6

Application Details

Application Notes: WB Suggested Anti-RHOT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RHOT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Fransson, Ruusala, Aspenström: "The atypical Rho GTPases Miro-1 and Miro-2 have essential roles in mitochondrial trafficking." in: Biochemical and biophysical research communications, Vol. 344, Issue 2, pp. 500-10, 2006 (PubMed).