Parvin, beta (PARVB) antibody

Antigen: Parvin, beta (PARVB)

Synonyms: CGI-56, D15Gsk1, AI595373, AW742462, fd02e01, zgc:73117, wu:fd02e01, parvb, MGC69390, PARVB, MGC143245, MGC115486

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN405782

Additional Information

Alternative name: PARVB

Gene ID: PARVB

UniProt: Q96PN1

Immunogen: The immunogen for anti-PARVB antibody: synthetic peptide directed towards the N terminal of human PARVB

Sequence: LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTS KEDPKFKELV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PARVB antibody concentration is 1 mg/ml.

Description: Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.[supplied by OMIM].

Characteristics: Antigen Size: 397 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-PARVB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Extracellular Matrix

Restrictions: For Research Use only

Images

WB Suggested Anti-PARVB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Publications

Product: Johnstone, Mongroo, Rich et al.: "Parvin-beta inhibits breast cancer tumorigenicity and promotes CDK9-mediated peroxisome proliferator-activated receptor gamma 1 phosphorylation." in: Molecular and cellular biology, Vol. 28, Issue 2, pp. 687-704, 2008 (PubMed).