GINS Complex Subunit 2 (Psf2 Homolog) (GINS2) antibody

Antigen: GINS Complex Subunit 2 (Psf2 Homolog) (GINS2)

Synonyms: PSF2, Pfs2, HSPC037, AI323585, 2210013I18Rik, 4833427B12Rik, RGD1311055, pfs2, psf2, hspc037, zgc:112262, si:dkey-265o13.3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN405801

Additional Information

Alternative name: GINS2 / PSF2

Gene ID: GINS2

UniProt: Q9Y248

Immunogen: The immunogen for anti-GINS2 antibody: synthetic peptide directed towards the N terminal of human GINS2

Sequence: DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLP VEVPLWLAIN

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GINS2 antibody concentration is 1 mg/ml.

Description: The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4, MIM 610611), Psf1 (GINS1, MIM 610608), Psf2, and Psf3 (GINS3, MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM].

Characteristics: Antigen Size: 185 amino acids

Molecular Weight: 21kDa

Application Details

Application Notes: WB Suggested Anti-GINS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GINS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Publications

Product: Matsuoka, Ballif, Smogorzewska et al.: "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." in: Science (New York, N.Y.), Vol. 316, Issue 5828, pp. 1160-6, 2007 (PubMed).