Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1) antibody

Antigen: Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN405854

Additional Information

Alternative name: TMED1

Gene ID: TMED1

UniProt: Q13445

Immunogen: The immunogen for anti-TMED1 antibody: synthetic peptide directed towards the middle region of human TMED1

Sequence: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSF STISEKLVFF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMED1 antibody concentration is 1 mg/ml.

Description: TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Characteristics: Antigen Size: 227 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-TMED1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMED1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).