Transmembrane Protein 138 (TMEM138) (N-Term) antibody

Details for Product No. ABIN405886
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 1700113I01Rik, 2900055D14Rik, MGC79801
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Catalog no. ABIN405886
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM138
Sequence MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLV LFIIQDIAVL
Predicted Reactivity Human : 100 %, Bovine : 70 %, Dog : 70 %, Goat : 70 %, Rat : 70 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against TMEM138. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM138
Background TMEM138 is a multi-pass membrane protein.It belongs to the TMEM138 family. The function of the TMEM138 protein remains unknown.
Molecular Weight 19 kDa
Gene ID 51524
NCBI Accession NM_016464, NP_057548
UniProt Q9NPI0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 162 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
back to top