Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405886

Transmembrane Protein 138 (TMEM138) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700113I01Rik, 2900055D14Rik, MGC79801
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405886
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM138 antibody: synthetic peptide directed towards the N terminal of human TMEM138
Sequence MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLV LFIIQDIAVL
Predicted Reactivity Human : 100%, Bovine : 78%, Dog : 78%, Goat : 78%, Rat : 78%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against TMEM138. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM138
Background TMEM138 is a multi-pass membrane protein.It belongs to the TMEM138 family. The function of the TMEM138 protein remains unknown.
Molecular Weight 19kDa
Gene ID 51524
NCBI Accession NP_057548, NM_016464
UniProt Q9NPI0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM138 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Transmembrane Protein 138 (TMEM138)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon