Transmembrane Protein 168 (TMEM168) antibody

Antigen: Transmembrane Protein 168 (TMEM168)

Synonyms: FLJ13576, DKFZp564C012, AI462344, AI504145, 5730526F17Rik, 8430437G11Rik, RGD1307778, MGC53845, flj13576, MGC152038, tmem168, si:dkey-192l17.1, DKFZp469K0515

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN406077

Additional Information

Alternative name: TMEM168

Gene ID: TMEM168

UniProt: Q9H0V1

Immunogen: The immunogen for anti-TMEM168 antibody: synthetic peptide directed towards the C terminal of human TMEM168

Sequence: EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYG VSKRWSDYTL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMEM168 antibody concentration is 1 mg/ml.

Description: TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

Characteristics: Antigen Size: 697 amino acids

Molecular Weight: 80kDa

Application Details

Application Notes: WB Suggested Anti-TMEM168 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM168 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Publications

Product: Simpson, Wellenreuther, Poustka et al.: "Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing." in: EMBO reports, Vol. 1, Issue 3, pp. 287-92, 2001 (PubMed).