Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 12 Open Reading Frame 49 (C12orf49) antibody

Antigen

Chromosome 12 Open Reading Frame 49 (C12orf49)

Synonyms FLJ21415, C9H12orf49, C12orf49, MGC139665, MGC80896
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Dog (Canine), Zebrafish, Fruit Fly (Drosophila melanogaster)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406084
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C12orf49
Gene ID C12orf49
UniProt Q9H741
Immunogen The immunogen for anti-C12orf49 antibody: synthetic peptide directed towards the C terminal of human C12orf49
Sequence LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHE NTYRDPIAKY
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C12orf49 antibody concentration is 1 mg/ml.
Description The exact function of C12orf49 remains unknown.
Characteristics Antigen Size: 205 amino acids
Molecular Weight 23kDa

Application Details

Application Notes WB Suggested Anti-C12orf49 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 12 Open Reading Frame 49 (C12orf49)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Cow (Bovine) (18), Dog (Canine) (18), Mouse (Murine) (18), Rat (Rattus) (18), Zebrafish (Danio rerio) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (3), C-Term,AA 172-202 (1)