PHD Finger Protein 19 (PHF19) antibody

Antigen: PHD Finger Protein 19 (PHF19)

Synonyms: PCL3, MTF2L1, MGC23929, MGC131698, MGC149712, MGC149713, 3110009G19Rik, 3321402G02Rik, pcl3, MGC147603

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN406115

Additional Information

Alternative name: PHF19 / PCL3

Gene ID: PHF19

UniProt: Q5T6S3-2

Immunogen: The immunogen for anti-PHF19 antibody: synthetic peptide directed towards the C terminal of human PHF19

Sequence: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSK QKGHTWALET

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PHF19 antibody concentration is 1 mg/ml.

Description: PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.

Characteristics: Antigen Size: 207 amino acids

Molecular Weight: 22kDa

Application Details

Application Notes: WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).