Zinc Finger Protein 780A (ZNF780A) antibody

Antigen: Zinc Finger Protein 780A (ZNF780A)

Synonyms: ZNF780

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN406116

Additional Information

Alternative name: ZNF780A

Gene ID: ZNF780A

Immunogen: The immunogen for anti-ZNF780A antibody: synthetic peptide directed towards the N terminal of human ZNF780A

Sequence: TSRRYPDLELKYGPEKVSPENDTSEVNLPKQVIKQISTTL GIEAFYFRND

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF780A antibody concentration is 1 mg/ml.

Description: ZNF780A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 17 C2H2-type zinc fingers and 1 KRAB domain. ZNF780A may be involved in transcriptional regulation.

Characteristics: Antigen Size: 607 amino acids

Molecular Weight: 70kDa

Application Details

Application Notes: WB Suggested Anti-ZNF780A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF780A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate

Publications

Product: Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).