PHD Finger Protein 12 (PHF12) antibody

Antigen: PHD Finger Protein 12 (PHF12)

Synonyms: PF1, FLJ34122, KIAA1523, MGC131914, mKIAA1523, F630045O13, 2410142K10Rik, MGC109651, MGC53023

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN406118

Additional Information

Alternative name: PHF12 / Pf1

Gene ID: PHF12

UniProt: Q96QT6

Immunogen: The immunogen for anti-PHF12 antibody: synthetic peptide directed towards the C terminal of human PHF12

Sequence: NVLYSCDFSEKTPPTPPSSIVAKVQSVIRRRRHQKQDEEP SEEAAMMSSQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PHF12 antibody concentration is 1 mg/ml.

Description: PHF12 acts as a transcriptional repressor. It is involved in recruitment of functional SIN3A complexes to DNA. PHF12 represses transcription at least in part through the activity of an associated histone deacetylase (HDAC). IT may also repress transcription in a SIN3A-independent manner through recruitment of functional AES complexes to DNA.

Characteristics: Antigen Size: 1004 amino acids

Molecular Weight: 110kDa

Application Details

Application Notes: WB Suggested Anti-PHF12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PHF12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).