Chromosome 10 Open Reading Frame 33 (C10ORF33) antibody

Antigen: Chromosome 10 Open Reading Frame 33 (C10ORF33)

Synonyms: FP3420, C10orf33, FLJ12197, FLJ23849, MGC13047, MGC128628, C26H10orf33, DKFZp469H0233

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN406164

Additional Information

Alternative name: PYROXD2

Gene ID: C10orf33

UniProt: Q8N2H3

Immunogen: The immunogen for anti-C10orf33 antibody: synthetic peptide directed towards the N terminal of human C10orf33

Sequence: MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVI GAGHNGLVAA

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C10orf33 antibody concentration is 1 mg/ml.

Description: The exact function of C10orf33 remains unknown.

Characteristics: Antigen Size: 581 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-C10orf33 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C10orf33 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).