DPH2 Homolog (S. Cerevisiae) (DPH2) antibody

Antigen: DPH2 Homolog (S. Cerevisiae) (DPH2)

Synonyms: Dph2l2, AI467389, 9130020C19Rik, MGC109459, DPH2, MGC143119, DKFZp469J0123, DPH2L2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN406193

Additional Information

Alternative name: DPH2 / DPH2L2

Gene ID: DPH2

UniProt: Q9BQC3

Immunogen: The immunogen for anti-DPH2 antibody: synthetic peptide directed towards the N terminal of human DPH2

Sequence: TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACL SPPARPLPVA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DPH2 antibody concentration is 1 mg/ml.

Description: DPH2 gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.

Characteristics: Antigen Size: 489 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-DPH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DPH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Publications

Product: Liu, Milne, Kuremsky et al.: "Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9487-97, 2004 (PubMed).