Pallidin Homolog (Mouse) (PLDN) antibody

Antigen: Pallidin Homolog (Mouse) (PLDN)

Synonyms: pa, BLOC-1, Stx13bp1, PA, PALLID, CG14133, DmelCG14133, MGC114534, PLDN, LOC100226487, pldn

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN406445

Additional Information

Alternative name: Pallidin (PLDN)

Gene ID: PLDN

UniProt: Q9UL45

Immunogen: The immunogen for anti-PLDN antibody: synthetic peptide directed towards the middle region of human PLDN

Sequence: EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELT QNQVVLLDTL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PLDN antibody concentration is 1 mg/ml.

Description: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 172 amino acids

Molecular Weight: 20kDa

Application Details

Application Notes: WB Suggested Anti-PLDN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PLDN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).