Inositol-Tetrakisphosphate 1-Kinase (ITPK1) antibody

Antigen: Inositol-Tetrakisphosphate 1-Kinase (ITPK1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN406459

Additional Information

Alternative name: ITPK1

Gene ID: ITPK1

UniProt: Q13572

Immunogen: The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the N terminal of human ITPK1

Sequence: MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSL ELVHRFQEYI

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ITPK1 antibody concentration is 1 mg/ml.

Description: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.

Characteristics: Antigen Size: 414 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-ITPK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-ITPK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Chamberlain, Qian, Stiles et al.: "Integration of inositol phosphate signaling pathways via human ITPK1." in: The Journal of biological chemistry, Vol. 282, Issue 38, pp. 28117-25, 2007 (PubMed).