Tropomodulin 2 (TMOD2) antibody

Antigen: Tropomodulin 2 (TMOD2)

Synonyms: NTMOD, N-Tmod, zgc:86648

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish, Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN406467

Additional Information

Alternative name: Tropomodulin-2 (TMOD2)

Gene ID: TMOD2

UniProt: Q9NZR1

Immunogen: The immunogen for anti-TMOD2 antibody: synthetic peptide directed towards the N terminal of human TMOD2

Sequence: MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNG MAKNGSEADI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMOD2 antibody concentration is 1 mg/ml.

Description: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Characteristics: Antigen Size: 351 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-TMOD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMOD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Pawlak, McGarvey, Nguyen et al.: "Alterations in tropomyosin isoform expression in human transitional cell carcinoma of the urinary bladder." in: International journal of cancer. Journal international du cancer, Vol. 110, Issue 3, pp. 368-73, 2004 (PubMed).