Calcyphosine (CAPS) antibody

Antigen: Calcyphosine (CAPS)

Synonyms: CAPS1, MGC126562, AW125205, MGC74120, 1700028N11Rik, CAPS, caps1, MGC84373, MGC142635

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rabbit

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN406689

Additional Information

Alternative name: Calcyphosin

Gene ID: CAPS

UniProt: Q13938

Immunogen: The immunogen for anti-CAPS antibody: synthetic peptide directed towards the N terminal of human CAPS

Sequence: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSL DADEFRQGLA

Cross-Reactivity: Human, Rabbit

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CAPS antibody concentration is 1 mg/ml.

Description: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.

Characteristics: Antigen Size: 189 amino acids

Molecular Weight: 21kDa

Application Details

Application Notes: WB Suggested Anti-CAPS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CAPS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Sample Type: Huh7 HepG2 (50ug)
Primary Antibody Dilution:1:500
Image Submitted By: Partha Kasturi
University of Kansas Medical Center

Publications

Product: Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).