Did you know that you can buy products from over 140 different suppliers from us?

ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1) (N-Term) antibody

Details for Product No. ABIN406715
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Synonyms ATP6C, ATP6D, VATC, Vma5, U13839, 1700025B18Rik, vatC, ATPase, atp6v1c1, wu:fd12h05, si:zc215i13.2
(2), (1), (1), (1)
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
(13), (7), (3), (1), (1)
(18), (1)
(2), (2), (2)
Western Blotting (WB)
(17), (12), (5), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406715
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ATP6V1C1
Sequence ldafvegvvkkvaqymadvledskdkvqenllangvdlvt yitrfqwdma
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against ATP6V1C1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ATP6V1C1
Background ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.
Molecular Weight 42 kDa
Gene ID 528
NCBI Accession NM_001695, NP_001686
UniProt P21283
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.

Antigen size: 382 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1) (N-Term) antibody WB Suggested Anti-ATP6V1C1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Hurtado-Lorenzo, Skinner, El Annan et al.: "V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway." in: Nature cell biology, Vol. 8, Issue 2, pp. 124-36, 2006 (PubMed).

Hosts (18), (1)
Reactivities (13), (7), (3), (1), (1)
Applications (17), (12), (5), (2), (1), (1)
Conjugates (2), (2), (2)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406715
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top