WD Repeat Domain 3 (WDR3) antibody

Antigen: WD Repeat Domain 3 (WDR3)

Synonyms: FLJ12796, AW546279, D030020G18Rik, sb:cb42, wu:fb92b07, MGC76073

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Xenopus laevis, Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN406737

Additional Information

Alternative name: WDR3

Gene ID: WDR3

UniProt: Q9UNX4

Immunogen: The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3

Sequence: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRK KREKLILTLT

Cross-Reactivity: Cow (Bovine), Chicken, Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WDR3 antibody concentration is 1 mg/ml.

Description: WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Characteristics: Antigen Size: 943 amino acids

Molecular Weight: 106kDa

Application Details

Application Notes: WB Suggested Anti-WDR3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WDR3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate

Publications

Product: Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).