Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406763

Nuclear Transcription Factor, X-Box Binding 1 (NFX1) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NFX2, NFX.1, Tex42, TEG-42, 1300017N15Rik, 3000003M19Rik, NFX1
Reactivity
»Alternatives Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406763
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NFX1 antibody: synthetic peptide directed towards the middle region of human NFX1
Sequence TLTGVLEREMQARPPPPIPHHRHQSDKNPGSSNLQKITKE PIIDYFDVQD
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Human : 100%, Bovine : 85%, Dog : 85%, Rabbit : 85%, Rat : 85%, Mouse : 76%
Characteristics Antigen Size: 1120 amino acids
Purification Affinity Purified
Alternative Name NFX1
Background MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. NFX1 is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma.MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. The protein encoded by this gene is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma. Three alternative splice variants, each of which encodes a different isoform, have been identified.
Molecular Weight 124kDa
Gene ID NFX1
UniProt Q12986
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Proteolysis / Ubiquitin, Adaptive Immunity
Application Notes WB Suggested Anti-NFX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-NFX1 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Katzenellenbogen, Egelkrout, Vliet-Gregg et al.: "NFX1-123 and poly(A) binding proteins synergistically augment activation of telomerase in human papillomavirus type 16 E6-expressing cells." in: Journal of virology, Vol. 81, Issue 8, pp. 3786-96, 2007 (PubMed).

Alternatives for antigen "Nuclear Transcription Factor, X-Box Binding 1 (NFX1)", type "Antibodies"
Hosts (18), (4)
Reactivities (22), (15), (15), (1), (1)
Applications (12), (11), (10), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1)
Beacon