Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7) antibody

Antigen: Transcription Factor 7 (T-Cell Specific, HMG-Box) (TCF7)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN486835

Additional Information

Alternative name: TCF7 / TCF1

Gene ID: TCF7

UniProt: P36402-2

Immunogen: The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7

Sequence: MQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDG NGQESLSMSS

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCF7 antibody concentration is 1 mg/ml.

Description: The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.

Characteristics: Antigen Size: 269 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Publications

Product: Willinger, Freeman, Herbert et al.: "Human naive CD8 T cells down-regulate expression of the WNT pathway transcription factors lymphoid enhancer binding factor 1 and transcription factor 7 (T cell factor-1) following antigen encounter in vitro and in vivo." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 176, Issue 3, pp. 1439-46, 2006 (PubMed).