Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

GS Homeobox 1 (GSX1) antibody

Antigen

GS Homeobox 1 (GSX1)

Synonyms Gsh1, Gsh-1, GSH1, gsh1, MGC110817, im:7138106, zgc:110817, MGC148669, gsh-1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN486866
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name GSX1
Gene ID GSX1
UniProt Q9H4S2
Immunogen The immunogen for anti-GSX1 antibody: synthetic peptide directed towards the N terminal of human GSX1
Sequence MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALH GLSPGACHAR
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-GSX1 antibody concentration is 1 mg/ml.
Description GSX1 is a probable transcription factor that binds to the DNA sequence 5'-GC[TA][AC]ATTA[GA]-3'. GSX1 activates the transcription of the GHRH gene. GSX1 plays an important role in pituitary development.
Characteristics Antigen Size: 264 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-GSX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Alternatives

Alternatives for antigen "GS Homeobox 1 (GSX1)", type "Antibodies"
Hosts Rabbit (25)
Reactivities Human (25), Mouse (Murine) (22), Rat (Rattus) (21), Dog (Canine) (19), Pig (Porcine) (18), Sheep (Ovine) (18), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (10), ELISA (9), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (2)