Meis Homeobox 1 (MEIS1) antibody
| Antigen | Meis Homeobox 1 (MEIS1) |
| Synonyms |
MGC43380, MGC138090, meis, 1323/07, 1422/04, Dm-HTH, Hth, Meis1, P53, anon-EST:Liang-2.13, clone 2.13, dtl, hth1, hth2, l(3)05745, l(3)86Ca, DmelCG17117, CG17117, cb224, meis1.1, id:ibd5078, wu:fb38b0 ...
show more
|
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish, Xenopus laevis |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
 |
1 reference available |
| Catalog no. | ABIN486894 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | MEIS1 |
| Gene ID | MEIS1 |
| UniProt | O00470 |
| Immunogen | The immunogen for anti-MEIS1 antibody: synthetic peptide directed towards the middle region of human MEIS1 |
| Sequence | GKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHD DTASTRSGGT |
| Cross-Reactivity | Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-MEIS1 antibody concentration is 1 mg/ml. |
| Description | Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. MEIS1 is a homeobox protein belonging to the TALE ('thr |
| Characteristics | Antigen Size: 390 amino acids |
| Molecular Weight | 43kDa |
| Synonyms | MGC43380, MGC138090, meis, 1323/07, 1422/04, Dm-HTH, Hth, Meis1, P53, anon-EST:Liang-2.13, clone 2.13, dtl, hth1, hth2, l(3)05745, l(3)86Ca, DmelCG17117, CG17117, cb224, meis1.1, id:ibd5078, wu:fb38b03, wu:fc02e11, wu:fd12a02 |
Application Details
| Application Notes |
WB Suggested Anti-MEIS1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Lung. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Stem Cells, Hematopoietic Progenitors, Transcription Factors |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-MEIS1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Lung |
Publications
| Product |
Robinson, Cheung, Kolaris et al.: "Prospective tracing of MLL-FRYL clone with low MEIS1 expression from emergence during neuroblastoma treatment to diagnosis of myelodysplastic syndrome." in: Blood, Vol. 111, Issue 7, pp. 3802-12, 2008 (PubMed).
|
Alternatives
Alternatives for antigen "Meis Homeobox 1 (MEIS1)", type "Antibodies"
| Hosts | Rabbit (33), Goat (4) |
| Reactivities | Human (35), Mouse (Murine) (29), Rat (Rattus) (23), Chicken (22), Dog (Canine) (21), Cow (Bovine) (20), Horse (Equine) (20), Pig (Porcine) (18), Xenopus laevis (4), Monkey (1), Zebrafish (1), Zebrafish (Danio rerio) (1) |
| Applications | Western Blotting (WB) (18), Immunofluorescence (IF) (15), ELISA (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1) |
| Conjugates | Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | Internal Region (5), N-Term (2), AA 170-220 (1), AA 280-330 (1), C-Term (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
