RHOD antibody

Antigen: RHOD

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN487183

Additional Information

Gene ID: RHOD

UniProt: O00212

Immunogen: The immunogen for anti-RHOD antibody: synthetic peptide directed towards the C terminal of human RHOD

Sequence: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQE AAEVALSSRG

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RHOD antibody concentration is 1 mg/ml.

Description: Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 210 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-RHOD Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.
Immunohistochemistry with Tonsil tissue at an antibody concentration of 5µg/ml using anti-RHOD antibody (ABIN487183).

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RHOD Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Immunohistochemistry with Tonsil tissue at an antibody concentration of 5µg/ml using anti-RHOD antibody (ARP42414_P050)

Publications

Product: Tong, Chugha, Hota et al.: "Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain." in: The Journal of biological chemistry, Vol. 282, Issue 51, pp. 37215-24, 2007 (PubMed).