Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Fas Apoptotic Inhibitory Molecule (FAIM) antibody

Antigen

Fas Apoptotic Inhibitory Molecule (FAIM)
Synonyms FAIM, FAIM1, faim, Toso, MGC144825, MGC144826, 1810037B05Rik, MGC115509
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN487272
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Fas Apoptotic Inhibitory Molecule (FAIM) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name FAIM
Gene ID FAIM
Immunogen The immunogen for anti-FAIM antibody: synthetic peptide directed towards the middle region of human FAIM
Sequence FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHD CYIKAVSSGK
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-FAIM antibody concentration is 1 mg/ml.
Description FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
Characteristics Antigen Size: 213 amino acids
Molecular Weight 24kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-FAIM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Segura, Sole, Pascual et al.: "The long form of Fas apoptotic inhibitory molecule is expressed specifically in neurons and protects them against death receptor-triggered apoptosis." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 27, Issue 42, pp. 11228-41, 2007 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Fas Apoptotic Inhibitory Molecule (FAIM)", type "Antibodies"
Hosts Rabbit (34), Goat (5)
Reactivities Human (34), Mouse (Murine) (25), Rat (Rattus) (23), Dog (Canine) (21), Cow (Bovine) (19), Zebrafish (Danio rerio) (17), Cat (Feline) (1), Chicken (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (23), Immunofluorescence (IF) (16), ELISA (15), Immunohistochemistry (IHC) (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), Internal Region (2), Center (1), N-Term (1), long form, AA 3-18 (1), short form (1)