OTU Domain Containing 6B (OTUD6B) antibody

Antigen: OTU Domain Containing 6B (OTUD6B)

Synonyms: DUBA5, CGI-77, AU015433, MGC103361, 2600013N14Rik, RGD1310024, MGC56305, zgc:56305, duba5, DKFZp459J184

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN487281

Additional Information

Alternative name: OTUD6B / DUBA5

Gene ID: OTUD6B

Immunogen: The immunogen for anti-OTUD6B antibody: synthetic peptide directed towards the middle region of human OTUD6B

Sequence: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVT RLVNIVTENC

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-OTUD6B antibody concentration is 1 mg/ml.

Description: Deubiquitinating enzymes (DUBs, see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Characteristics: Antigen Size: 323 amino acids

Molecular Weight: 37kDa

Application Details

Application Notes: WB Suggested Anti-OTUD6B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-OTUD6B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Publications

Product: Worby, Dixon: "Sorting out the cellular functions of sorting nexins." in: Nature reviews. Molecular cell biology, Vol. 3, Issue 12, pp. 919-31, 2002 (PubMed).