Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487302

Homeobox Protein OTX1 antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms jv, A730044F23Rik, OTX1X, otx1, cb769, zOtx1, fj99f05, wu:fj99f05, otx1-A, xotx1
Reactivity
»Alternatives Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Zebrafish
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487302
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the N terminal of human OTX1
Sequence KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSS PVRESSGSES
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Guinea pig : 92%, Rat : 85%, Zebrafish : 85%, Mouse : 78%
Characteristics Antigen Size: 354 amino acids
Purification Affinity Purified
Alternative Name OTX1
Background OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.
Molecular Weight 37kDa
Gene ID OTX1
UniProt P32242
Application Notes WB Suggested Anti-OTX1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-OTX1 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Homeobox Protein OTX1", type "Antibodies"
Hosts (28), (9)
Reactivities (36), (18), (17), (16), (16), (12), (2), (1), (1), (1), (1), (1)
Applications (24), (18), (10), (4), (3), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (3), (3), (2), (2), (2), (1), (1)
Beacon