Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Paired Box 8 (PAX8) antibody

Antigen

Paired Box 8 (PAX8)
Synonyms MGC93376, PAX-8, PAX8, XPax8, pax-8, XPax-8, MGC147590, DKFZp469G1314
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN501324
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Paired Box 8 (PAX8) antibody

anti-Paired Box 8 (PAX8) antibody (2)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name PAX8
Gene ID PAX8
UniProt Q06710-4
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8
Sequence SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSH TKGEQGERWW
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PAX8 antibody concentration is 1 mg/ml.
Description PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development
Characteristics Antigen Size: 321 amino acids
Molecular Weight 35kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-PAX8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: NCI-H226 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Nonaka, Tang, Chiriboga et al.: "Diagnostic utility of thyroid transcription factors Pax8 and TTF-2 (FoxE1) in thyroid epithelial neoplasms." in: Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, Vol. 21, Issue 2, pp. 192-200, 2008 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Paired Box 8 (PAX8)", type "Antibodies"
Hosts Rabbit (44), Mouse (20), Goat (10)
Reactivities Human (70), Rat (Rattus) (39), Mouse (Murine) (35), Cow (Bovine) (24), Dog (Canine) (20), Pig (Porcine) (5), Rabbit (5), Cat (Feline) (1), Chicken (1), Fruit Fly (Drosophila melanogaster) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (50), ELISA (43), Immunofluorescence (IF) (24), Immunohistochemistry (IHC) (20), Immunoprecipitation (IP) (11), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), Immunocytochemistry (ICC) (4), Flow Cytometry (FACS) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (Dot) (1), Immunoassay (IA) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (7), N-Term (4), C-Term (3), AA 191-206 (1), Center (1)