Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501390

Two Pore Segment Channel 1 (TPCN1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TPC1, Tpc1, mKIAA1169, 5730403B01Rik, ATCCH1, ATTPC1, CALCIUM CHANNEL 1, FATTY ACID OXYGENATION UPREGULATED 2, FOU2, T5L23.5, two-pore channel 1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501390
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1
Sequence YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYL MELATALLLL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Mouse : 92%
Characteristics This is a rabbit polyclonal antibody against TPCN1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TPCN1
Background TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).
Molecular Weight 94kDa
Gene ID 53373
NCBI Accession NP_060371, NM_017901
UniProt Q9ULQ1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TPCN1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clapham, Garbers: "International Union of Pharmacology. L. Nomenclature and structure-function relationships of CatSper and two-pore channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 451-4, 2005 (PubMed).

Alternatives for antigen "Two Pore Segment Channel 1 (TPCN1)", type "Antibodies"
Hosts (11), (1)
Reactivities (6), (4), (3), (3)
Applications (12), (5), (3), (1), (1), (1)
Epitopes (4), (2), (1), (1), (1), (1)
Beacon