Two Pore Segment Channel 1 (TPCN1) (N-Term) antibody

Details for Product No. ABIN501390
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TPC1, Tpc1, mKIAA1169, 5730403B01Rik, ATCCH1, ATTPC1, CALCIUM CHANNEL 1, FATTY ACID OXYGENATION UPREGULATED 2, FOU2, T5L23.5, two-pore channel 1
Epitope
N-Term
(5), (3), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(5), (4), (3), (3)
Host
Rabbit
(10), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (5), (3)
Pubmed 1 reference available
Catalog no. ABIN501390
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TPCN1
Sequence YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYL MELATALLLL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against TPCN1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TPCN1
Background TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).
Molecular Weight 94 kDa
Gene ID 53373
NCBI Accession NM_017901, NP_060371
UniProt Q9ULQ1
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 816 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Two Pore Segment Channel 1 (TPCN1) (N-Term) antibody WB Suggested Anti-TPCN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate
Background publications Clapham, Garbers: "International Union of Pharmacology. L. Nomenclature and structure-function relationships of CatSper and two-pore channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 451-4, 2005 (PubMed).

Hosts (10), (1)
Reactivities (5), (4), (3), (3)
Applications (11), (5), (3)
Epitopes (5), (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top