Two Pore Segment Channel 1 (TPCN1) antibody

Antigen: Two Pore Segment Channel 1 (TPCN1)

Synonyms: TPC1, FLJ20612, KIAA1169, Tpc1, mKIAA1169, 5730403B01Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN501390

Additional Information

Alternative name: TPCN1

Gene ID: TPCN1

UniProt: Q9ULQ1

Immunogen: The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1

Sequence: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYL MELATALLLL

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TPCN1 antibody concentration is 1 mg/ml.

Description: TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).[supplied by OMIM].

Characteristics: Antigen Size: 816 amino acids

Molecular Weight: 94kDa

Application Details

Application Notes: WB Suggested Anti-TPCN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-TPCN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate

Publications

Product: Clapham, Garbers: "International Union of Pharmacology. L. Nomenclature and structure-function relationships of CatSper and two-pore channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 451-4, 2005 (PubMed).