Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Potassium Channel Tetramerisation Domain Containing 15 (KCTD15) antibody

Antigen

Potassium Channel Tetramerisation Domain Containing 15 (KCTD15)

Synonyms MGC2628, MGC25497, zgc:100865
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Dog (Canine), Chicken

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501400
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name KCTD15
Gene ID KCTD15
UniProt Q96SI1-2
Immunogen The immunogen for anti-KCTD15 antibody: synthetic peptide directed towards the N terminal of human KCTD15
Sequence PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLT KYPDSRISRL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-KCTD15 antibody concentration is 1 mg/ml.
Description KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.
Characteristics Antigen Size: 234 amino acids
Molecular Weight 26kDa

Application Details

Application Notes WB Suggested Anti-KCTD15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Signaling, Metabolism, Transporters
Restrictions For Research Use only

Publications

Product Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).

Alternatives

Alternatives for antigen "Potassium Channel Tetramerisation Domain Containing 15 (KCTD15)", type "Antibodies"
Hosts Rabbit (13), Mouse (7)
Reactivities Human (20), Rat (Rattus) (7), Mouse (Murine) (6), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (20), ELISA (15), Immunofluorescence (IF) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (IHC) (3), Immunocytochemistry (ICC) (2), Immunoprecipitation (IP) (1)
Epitopes C-Term (4), AA 1-234 (1), C-Term,AA 262-291 (1), N-Term (1)