SP110 Nuclear Body Protein (SP110) antibody

Antigen: SP110 Nuclear Body Protein (SP110)

Synonyms: IPR1, VODI, IFI41, IFI75, FLJ22835, Ipr1, 52kDa, Ifi75, MGC118608, 5031415C07Rik, 5830484A20Rik, ENSMUSG00000075603, MGC124651, SP110

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501509

Additional Information

Alternative name: SP110

Gene ID: SP110

UniProt: Q9HB58-6

Immunogen: The immunogen for anti-SP110 antibody: synthetic peptide directed towards the middle region of human SP110

Sequence: DMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFH EANDGGFWTL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SP110 antibody concentration is 1 mg/ml.

Description: The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. SP110 is a member of the SP100/SP140 family of nuclear body proteins and is a leukocyte-specific nuclear body component. The protein can function as a

Characteristics: Antigen Size: 713 amino acids

Molecular Weight: 81kDa

Application Details

Application Notes: WB Suggested Anti-SP110 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-SP110 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate

Publications

Product: Cliffe, Wong, Taylor et al.: "The first prenatal diagnosis for veno-occlusive disease and immunodeficiency syndrome, an autosomal recessive condition associated with mutations in SP110." in: Prenatal diagnosis, Vol. 27, Issue 7, pp. 674-6, 2007 (PubMed).