Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cytokine Receptor-Like Factor 1 (CRLF1) antibody

Antigen

Cytokine Receptor-Like Factor 1 (CRLF1)

Synonyms CLF, NR6, CISS, CISS1, CLF-1, zcytor5, CRLM3, NR6.1, CRLF1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus), Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501581
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CRLF1
Gene ID CRLF1
UniProt O75462
Immunogen The immunogen for anti-CRLF1 antibody: synthetic peptide directed towards the middle region of human CRLF1
Sequence QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVS NQTSCRLAGL
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CRLF1 antibody concentration is 1 mg/ml.
Description CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
Characteristics Antigen Size: 422 amino acids
Molecular Weight 46kDa

Application Details

Application Notes WB Suggested Anti-CRLF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Immunology, Innate Immunity, Cytokines
Restrictions For Research Use only

Publications

Product Crisponi, Crisponi, Meloni et al.: "Crisponi syndrome is caused by mutations in the CRLF1 gene and is allelic to cold-induced sweating syndrome type 1." in: American journal of human genetics, Vol. 80, Issue 5, pp. 971-81, 2007 (PubMed).

Alternatives

Alternatives for antigen "Cytokine Receptor-Like Factor 1 (CRLF1)", type "Antibodies"
Hosts Rabbit (23), Mouse (3)
Reactivities Human (25), Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Mouse (Murine) (18), Pig (Porcine) (18), Rat (Rattus) (18), Sheep (Ovine) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (11), ELISA (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2), Center (1)