SP110 Nuclear Body Protein (SP110) antibody

Antigen: SP110 Nuclear Body Protein (SP110)

Synonyms: IPR1, VODI, IFI41, IFI75, FLJ22835, Ipr1, 52kDa, Ifi75, MGC118608, 5031415C07Rik, 5830484A20Rik, ENSMUSG00000075603, MGC124651, SP110

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501609

Additional Information

Alternative name: SP110

Gene ID: SP110

UniProt: Q9HB58-6

Immunogen: The immunogen for anti-SP110 antibody: synthetic peptide directed towards the middle region of human SP110

Sequence: LKAYCHPQSSFFTGIPFNIRDYGEPFQEAMWLDLVKERLI TEMYTVAWFV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SP110 antibody concentration is 1 mg/ml.

Description: The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. SP110 is a member of the SP100/SP140 family of nuclear body proteins and is a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified.

Characteristics: Antigen Size: 713 amino acids

Molecular Weight: 81kDa

Application Details

Application Notes: WB Suggested Anti-SP110 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-SP110 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Publications

Product: Cliffe, Wong, Taylor et al.: "The first prenatal diagnosis for veno-occlusive disease and immunodeficiency syndrome, an autosomal recessive condition associated with mutations in SP110." in: Prenatal diagnosis, Vol. 27, Issue 7, pp. 674-6, 2007 (PubMed).