Transcription Factor 21 (TCF21) antibody
| Antigen | Transcription Factor 21 (TCF21) |
| Synonyms | POD1, bHLHa23, epc, Pod1, Pod-1, capsulin, epicardin, Msf-1, Capsulin, MGC112908, pod1, MGC82899, Epicardin, TCF21, MGC129111, MGC123313, zgc:123313, Tcf21, ACYPI002601, tcf21 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Chicken, Xenopus laevis |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
 |
1 reference available |
| Catalog no. | ABIN501658 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | TCF21 / POD1 |
| Gene ID | TCF21 |
| UniProt | O43680 |
| Immunogen | The immunogen for anti-TCF21 antibody: synthetic peptide directed towards the C terminal of human TCF21 |
| Sequence | RQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTAS RLCGTTAS |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-TCF21 antibody concentration is 1 mg/ml. |
| Description | The TCF21 gene encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney.TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. |
| Characteristics | Antigen Size: 179 amino acids |
| Molecular Weight | 20kDa |
Application Details
| Application Notes |
WB Suggested Anti-TCF21 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-TCF21 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
Publications
| Product |
Smith, Lin, Brena et al.: "Epigenetic regulation of the tumor suppressor gene TCF21 on 6q23-q24 in lung and head and neck cancer." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 4, pp. 982-7, 2006 (PubMed).
|
Alternatives
Alternatives for antigen "Transcription Factor 21 (TCF21)", type "Antibodies"
| Hosts | Rabbit (24) |
| Reactivities | Human (24), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Mouse (Murine) (19), Rat (Rattus) (19) |
| Applications | Immunofluorescence (IF) (15), Western Blotting (WB) (9), ELISA (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1) |
| Epitopes | C-Term (3), C-Term,AA 151-179 (1), N-Term (1) |
