Kelch-Like 5 (Drosophila) (KLHL5) antibody

Antigen: Kelch-Like 5 (Drosophila) (KLHL5)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN501784

Additional Information

Alternative name: KLHL5

Gene ID: KLHL5

UniProt: Q96PQ7

Immunogen: The immunogen for anti-KLHL5 antibody: synthetic peptide directed towards the middle region of human KLHL5

Sequence: LLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLG RAGACVVTVK

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KLHL5 antibody concentration is 1 mg/ml.

Description: The kelch-repeat protein family is a recently found new kind of actin-binding protein. It is characterized by tandemly arranged motifs of about 50 amino acids. Most members of the kelch-repeat family were cytoskeletal proteins implicated in various cellul

Characteristics: Antigen Size: 755 amino acids

Molecular Weight: 84kDa

Application Details

Application Notes: WB Suggested Anti-KLHL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Cytoskeleton, Microfilaments

Restrictions: For Research Use only

Images

WB Suggested Anti-KLHL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).