Chromatin Accessibility Complex 1 (CHRAC1) antibody

Antigen: Chromatin Accessibility Complex 1 (CHRAC1)

Synonyms: YCL1, CHARC1, CHARC15, CHRAC15, 2410152E03Rik, 2810406L04Rik, CHRAC1, MGC142339, chrac1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN501795

Additional Information

Alternative name: CHRAC1

Gene ID: CHRAC1

UniProt: Q9NRG0

Immunogen: The immunogen for anti-CHRAC1 antibody: synthetic peptide directed towards the middle region of human CHRAC1

Sequence: SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNE SDHDEADS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CHRAC1 antibody concentration is 1 mg/ml.

Description: CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM].

Characteristics: Antigen Size: 131 amino acids

Molecular Weight: 15kDa

Application Details

Application Notes: WB Suggested Anti-CHRAC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-CHRAC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Publications

Product: Collins, Poot, Kukimoto et al.: "An ACF1-ISWI chromatin-remodeling complex is required for DNA replication through heterochromatin." in: Nature genetics, Vol. 32, Issue 4, pp. 627-32, 2002 (PubMed).