Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Forkhead Box M1 (FOXM1) antibody

Antigen

Forkhead Box M1 (FOXM1)

Synonyms MPP2, TGT3, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, FOXM1B, HFH-11, TRIDENT, MPHOSPH2, FOXM1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501829
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name FOXM1
Gene ID FOXM1
UniProt Q08050
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the middle region of human FOXM1
Sequence ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNI NWSQFIPELQ
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-FOXM1 antibody concentration is 1 mg/ml.
Description This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Characteristics Antigen Size: 763 amino acids
Molecular Weight 84kDa

Application Details

Application Notes WB Suggested Anti-FOXM1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer, Transcription Factors, Cell Cycle, Kinases/Phosphatases
Restrictions For Research Use only

Publications

Product Laoukili, Alvarez, Meijer et al.: "Activation of FoxM1 during G2 requires cyclin A/Cdk-dependent relief of autorepression by the FoxM1 N-terminal domain." in: Molecular and cellular biology, Vol. 28, Issue 9, pp. 3076-87, 2008 (PubMed).

Alternatives

Alternatives for antigen "Forkhead Box M1 (FOXM1)", type "Antibodies"
Hosts Rabbit (35), Mouse (5)
Reactivities Human (40), Mouse (Murine) (24), Rat (Rattus) (24), Dog (Canine) (21), Horse (Equine) (18), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1)
Applications Western Blotting (WB) (22), Immunofluorescence (IF) (17), ELISA (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (2), Immunoprecipitation (IP) (2), Dot Blot (Dot) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (3), Internal Region (2), C-Term (1)